PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00568.1_g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 326aa    MW: 37046.1 Da    PI: 7.2828
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00568.1_g00009.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.32.5e-56201461129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeel+++yLk+kv ++ +++  +i evd++kvePwdLp k+k +ekewyfF+ rd+ky+tg r+nratk+gyWkat
  Rsa1.0_00568.1_g00009.1  20 LPPGFRFHPTDEELISYYLKPKVLNSLFSA-VAIGEVDLNKVEPWDLPWKAKIGEKEWYFFCVRDRKYPTGLRTNRATKAGYWKAT 104
                              79*************************999.67***************98999********************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              gkdke+++ +++lvg+kktLvfykgrapkg+kt+Wvmheyrle
  Rsa1.0_00568.1_g00009.1 105 GKDKEIFR-EKSLVGMKKTLVFYKGRAPKGVKTNWVMHEYRLE 146
                              ********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.49E-6217170IPR003441NAC domain
PROSITE profilePS5100558.28820170IPR003441NAC domain
PfamPF023653.5E-3021145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0042542Biological Processresponse to hydrogen peroxide
GO:0051091Biological Processpositive regulation of sequence-specific DNA binding transcription factor activity
GO:1900057Biological Processpositive regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MDCEVSRTRE IVEDSELIDL PPGFRFHPTD EELISYYLKP KVLNSLFSAV AIGEVDLNKV  60
EPWDLPWKAK IGEKEWYFFC VRDRKYPTGL RTNRATKAGY WKATGKDKEI FREKSLVGMK  120
KTLVFYKGRA PKGVKTNWVM HEYRLEGEYA IDNLPKTAKN EWVISRVFQK QGDGKKMHIS  180
SLRMLGSGIN QFKPVGLPPL MDSSTYLKSR GDTSAGSLSH VTCFSDQTTE DKSHFSESKD  240
ESNFTMIGSS STHLIPNIGS MFHHNPVFMQ DNTSILKMLL DSEETQFKKN LQDLGTSDNE  300
LIASSWNGHD ISGSTAPVEV ACFWNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-531817615171NO APICAL MERISTEM PROTEIN
1ut4_B1e-531817615171NO APICAL MERISTEM PROTEIN
1ut7_A1e-531817615171NO APICAL MERISTEM PROTEIN
1ut7_B1e-531817615171NO APICAL MERISTEM PROTEIN
4dul_A1e-531817615171NAC domain-containing protein 19
4dul_B1e-531817615171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7382720.0KF738272.1 Brassica napus NAC transcription factor 59 (NAC59.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009111778.10.0PREDICTED: NAC domain-containing protein 100-like
RefseqXP_013660809.10.0PREDICTED: NAC domain-containing protein 59-like isoform X1
SwissprotQ9LJW31e-168NAC59_ARATH; NAC domain-containing protein 59
TrEMBLM4F5670.0M4F567_BRARP; Uncharacterized protein
STRINGBra036223.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40028174
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G29035.11e-170NAC domain containing protein 3